![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest |
![]() | Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) ![]() |
![]() | Family c.59.1.0: automated matches [254241] (1 protein) not a true family |
![]() | Protein automated matches [254550] (3 species) not a true protein |
![]() | Species Escherichia coli [TaxId:668369] [255651] (2 PDB entries) |
![]() | Domain d2wjpa3: 2wjp A:298-439 [244149] Other proteins in same PDB: d2wjpa1, d2wjpa2 automated match to d4uaga2 complexed with azi, cl, d17, dms, so4 |
PDB Entry: 2wjp (more details), 1.6 Å
SCOPe Domain Sequences for d2wjpa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wjpa3 c.59.1.0 (A:298-439) automated matches {Escherichia coli [TaxId: 668369]} glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld qfknfeqrgnefarlakelgsh
Timeline for d2wjpa3: