Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d2wbjg2: 2wbj G:114-202 [244095] Other proteins in same PDB: d2wbja1, d2wbja2, d2wbjb1, d2wbjc1, d2wbje1, d2wbje2, d2wbjf1, d2wbjg1 automated match to d2f54d2 complexed with nag, so4 |
PDB Entry: 2wbj (more details), 3 Å
SCOPe Domain Sequences for d2wbjg2:
Sequence, based on SEQRES records: (download)
>d2wbjg2 b.1.1.2 (G:114-202) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
>d2wbjg2 b.1.1.2 (G:114-202) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksnsava wsnksdfacanafnnsiipedtffps
Timeline for d2wbjg2: