Lineage for d2vzma_ (2vzm A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005933Species Streptomyces venezuelae [TaxId:54571] [255065] (14 PDB entries)
  8. 2005934Domain d2vzma_: 2vzm A: [243962]
    automated match to d4dnja_
    complexed with hem, nrb; mutant

Details for d2vzma_

PDB Entry: 2vzm (more details), 1.85 Å

PDB Description: crystal structure of the narbomycin-bound pikc d50n mutant
PDB Compounds: (A:) cytochrome p450 monooxygenase

SCOPe Domain Sequences for d2vzma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vzma_ a.104.1.0 (A:) automated matches {Streptomyces venezuelae [TaxId: 54571]}
ppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladprfs
kdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdglv
damlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqtam
aemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettvnl
iangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvipa
gdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavral
lercpdlaldvspgelvwypnpmirglkalpirwr

SCOPe Domain Coordinates for d2vzma_:

Click to download the PDB-style file with coordinates for d2vzma_.
(The format of our PDB-style files is described here.)

Timeline for d2vzma_: