![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Streptomyces venezuelae [TaxId:54571] [255065] (14 PDB entries) |
![]() | Domain d2vzmb_: 2vzm B: [243963] automated match to d4dnja_ complexed with hem, nrb; mutant |
PDB Entry: 2vzm (more details), 1.85 Å
SCOPe Domain Sequences for d2vzmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vzmb_ a.104.1.0 (B:) automated matches {Streptomyces venezuelae [TaxId: 54571]} pvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladprfsk dwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdglvd amlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqtama emsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettvnli angmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvipag dtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavrall ercpdlaldvspgelvwypnpmirglkalpirwr
Timeline for d2vzmb_: