SCOPe 2.04: Domain d2vtea3: 2vte A:298-439

Lineage for d2vtea3 (2vte A:298-439)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest

4. Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families)

5. Family c.59.1.0: automated matches [254241] (1 protein)
   not a true family

6. Protein automated matches [254550] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255259] (8 PDB entries)

8. Domain d2vtea3: 2vte A:298-439 [243944]
   Other proteins in same PDB: d2vtea1, d2vtea2
   automated match to d4uaga2
   complexed with ik4, so4

Details for d2vtea3

PDB Entry: 2vte, 2.2 Å

PDB Description: crystal structure of murd ligase in complex with d-glu containing sulfonamide inhibitor

PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2vtea3:

Sequence; same for both SEQRES and ATOM records:

>d2vtea3 c.59.1.0 (A:298-439) automated matches {Escherichia coli [TaxId: 562]}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelgsh

Timeline for d2vtea3:

• d2vtea3 is new in SCOPe 2.04-stable
  
• d2vtea3 appears in SCOPe 2.05
  
• d2vtea3 appears in the current release, SCOPe 2.08