![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
![]() | Protein automated matches [191162] (29 species) not a true protein |
![]() | Species Legionella pneumophila [TaxId:446] [255596] (2 PDB entries) |
![]() | Domain d2vcda_: 2vcd A: [243856] automated match to d3oe2a_ complexed with rap |
PDB Entry: 2vcd (more details)
SCOPe Domain Sequences for d2vcda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vcda_ d.26.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 446]} fnkkadenkvkgeafltenknkpgvvvlpsglqykvinsgngvkpgksdtvtveytgrli dgtvfdstektgkpatfqvsqvipgwtealqlmpagstweiyvpsglaygprsvggpigp netlifkihlisvkkss
Timeline for d2vcda_: