Lineage for d2vcda_ (2vcd A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941690Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2941691Protein automated matches [191162] (29 species)
    not a true protein
  7. 2941788Species Legionella pneumophila [TaxId:446] [255596] (2 PDB entries)
  8. 2941789Domain d2vcda_: 2vcd A: [243856]
    automated match to d3oe2a_
    complexed with rap

Details for d2vcda_

PDB Entry: 2vcd (more details)

PDB Description: solution structure of the fkbp-domain of legionella pneumophila mip in complex with rapamycin
PDB Compounds: (A:) outer membrane protein mip

SCOPe Domain Sequences for d2vcda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vcda_ d.26.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 446]}
fnkkadenkvkgeafltenknkpgvvvlpsglqykvinsgngvkpgksdtvtveytgrli
dgtvfdstektgkpatfqvsqvipgwtealqlmpagstweiyvpsglaygprsvggpigp
netlifkihlisvkkss

SCOPe Domain Coordinates for d2vcda_:

Click to download the PDB-style file with coordinates for d2vcda_.
(The format of our PDB-style files is described here.)

Timeline for d2vcda_: