Lineage for d1ghoo4 (1gho O:731-1023)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58106Fold b.30: Supersandwich [49993] (4 superfamilies)
  4. 58107Superfamily b.30.1: beta-Galactosidase, domain 5 [49994] (1 family) (S)
  5. 58108Family b.30.1.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 58109Protein beta-Galactosidase, domain 5 [49996] (1 species)
  7. 58110Species Escherichia coli [TaxId:562] [49997] (7 PDB entries)
  8. 58145Domain d1ghoo4: 1gho O:731-1023 [24380]
    Other proteins in same PDB: d1ghoi1, d1ghoi2, d1ghoi3, d1ghoi5, d1ghoj1, d1ghoj2, d1ghoj3, d1ghoj5, d1ghok1, d1ghok2, d1ghok3, d1ghok5, d1ghol1, d1ghol2, d1ghol3, d1ghol5, d1ghom1, d1ghom2, d1ghom3, d1ghom5, d1ghon1, d1ghon2, d1ghon3, d1ghon5, d1ghoo1, d1ghoo2, d1ghoo3, d1ghoo5, d1ghop1, d1ghop2, d1ghop3, d1ghop5

Details for d1ghoo4

PDB Entry: 1gho (more details), 2.5 Å

PDB Description: e. coli (lac z) beta-galactosidase (ncs constrained monomer-monoclinic)

SCOP Domain Sequences for d1ghoo4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghoo4 b.30.1.1 (O:731-1023) beta-Galactosidase, domain 5 {Escherichia coli}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOP Domain Coordinates for d1ghoo4:

Click to download the PDB-style file with coordinates for d1ghoo4.
(The format of our PDB-style files is described here.)

Timeline for d1ghoo4: