Lineage for d1ghoi5 (1gho I:334-625)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64720Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) (S)
  5. 64889Family c.1.8.3: beta-glycanases [51487] (14 proteins)
  6. 64894Protein beta-Galactosidase, domain 3 [51510] (1 species)
  7. 64895Species Escherichia coli [TaxId:562] [51511] (7 PDB entries)
  8. 64924Domain d1ghoi5: 1gho I:334-625 [28873]
    Other proteins in same PDB: d1ghoi1, d1ghoi2, d1ghoi3, d1ghoi4, d1ghoj1, d1ghoj2, d1ghoj3, d1ghoj4, d1ghok1, d1ghok2, d1ghok3, d1ghok4, d1ghol1, d1ghol2, d1ghol3, d1ghol4, d1ghom1, d1ghom2, d1ghom3, d1ghom4, d1ghon1, d1ghon2, d1ghon3, d1ghon4, d1ghoo1, d1ghoo2, d1ghoo3, d1ghoo4, d1ghop1, d1ghop2, d1ghop3, d1ghop4

Details for d1ghoi5

PDB Entry: 1gho (more details), 2.5 Å

PDB Description: e. coli (lac z) beta-galactosidase (ncs constrained monomer-monoclinic)

SCOP Domain Sequences for d1ghoi5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghoi5 c.1.8.3 (I:334-625) beta-Galactosidase, domain 3 {Escherichia coli}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1ghoi5:

Click to download the PDB-style file with coordinates for d1ghoi5.
(The format of our PDB-style files is described here.)

Timeline for d1ghoi5: