Lineage for d2rsta1 (2rst A:2-132)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061886Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2061887Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2061888Protein 29-kDa galactose-binding lectin [159148] (1 species)
    duplication: tadem repeat of two Ricin B-like domains
  7. 2061889Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [159149] (5 PDB entries)
    Uniprot O96048 131-260
  8. 2061898Domain d2rsta1: 2rst A:2-132 [243770]
    Other proteins in same PDB: d2rsta2
    automated match to d2zqna_

Details for d2rsta1

PDB Entry: 2rst (more details)

PDB Description: NMR structure of the C-terminal domain of EW29
PDB Compounds: (A:) 29-kDa galactose-binding lectin

SCOPe Domain Sequences for d2rsta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rsta1 b.42.2.1 (A:2-132) 29-kDa galactose-binding lectin {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
kpkffyikselngkvldiegqnpapgskiitwdqkkgptavnqlwytdqqgvirsklndf
aidasheqietqpfdpnnpkrawivsgntiaqlsdrdivldiiksdkeagahicawkqhg
gpnqkfiiese

SCOPe Domain Coordinates for d2rsta1:

Click to download the PDB-style file with coordinates for d2rsta1.
(The format of our PDB-style files is described here.)

Timeline for d2rsta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rsta2