SCOPe 2.08: Domain d2rsda1: 2rsd A:107-172

Lineage for d2rsda1 (2rsd A:107-172)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.0: automated matches [191482] (1 protein)
   not a true family

6. Protein automated matches [190772] (6 species)
   not a true protein

7. Species Oryza sativa [TaxId:39947] [255589] (1 PDB entry)

8. Domain d2rsda1: 2rsd A:107-172 [243766]
   Other proteins in same PDB: d2rsda2
   automated match to d1wewa_
   complexed with zn

Details for d2rsda1

PDB Entry: 2rsd

PDB Description: Solution structure of the plant homeodomain (PHD) of the E3 SUMO ligase Siz1 from rice

PDB Compounds: (A:) E3 SUMO-protein ligase SIZ1

SCOPe Domain Sequences for d2rsda1:

Sequence; same for both SEQRES and ATOM records:

>d2rsda1 g.50.1.0 (A:107-172) automated matches {Oryza sativa [TaxId: 39947]}
dsfqpeakvrcicsstmvndsmiqcedqrcqvwqhlncvlipdkpgesaevppvfycelc
rlsrad

Timeline for d2rsda1:

• d2rsda1 first appeared in SCOPe 2.04, called d2rsda_
  
• d2rsda1 appears in SCOPe 2.07