![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) ![]() |
![]() | Family g.50.1.0: automated matches [191482] (1 protein) not a true family |
![]() | Protein automated matches [190772] (6 species) not a true protein |
![]() | Species Oryza sativa [TaxId:39947] [255589] (1 PDB entry) |
![]() | Domain d2rsda1: 2rsd A:107-172 [243766] Other proteins in same PDB: d2rsda2 automated match to d1wewa_ complexed with zn |
PDB Entry: 2rsd (more details)
SCOPe Domain Sequences for d2rsda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rsda1 g.50.1.0 (A:107-172) automated matches {Oryza sativa [TaxId: 39947]} dsfqpeakvrcicsstmvndsmiqcedqrcqvwqhlncvlipdkpgesaevppvfycelc rlsrad
Timeline for d2rsda1: