PDB entry 2rsd

View 2rsd on RCSB PDB site
Description: Solution structure of the plant homeodomain (PHD) of the E3 SUMO ligase Siz1 from rice
Class: ligase
Keywords: E3 SUMO ligase, plant homeodomain (PHD), histone binding, LIGASE
Deposited on 2012-01-12, released 2012-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 SUMO-protein ligase SIZ1
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: SIZ1, Os05g0125000, LOC_Os05g03430, OSJNBb0079L11.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6L4L4 (2-67)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d2rsda1, d2rsda2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rsdA (A:)
    gsdsfqpeakvrcicsstmvndsmiqcedqrcqvwqhlncvlipdkpgesaevppvfyce
    lcrlsrad