SCOPe 2.05: Domain d2r8qa_: 2r8q A:

Lineage for d2r8qa_ (2r8q A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (6 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [255578] (1 PDB entry)

8. Domain d2r8qa_: 2r8q A: [243663]
   automated match to d4i15a_
   complexed with ibm, mg, zn

Details for d2r8qa_

PDB Entry: 2r8q, 1.5 Å

PDB Description: Structure of LmjPDEB1 in complex with IBMX

PDB Compounds: (A:) Class I phosphodiesterase PDEB1

SCOPe Domain Sequences for d2r8qa_:

Sequence; same for both SEQRES and ATOM records:

>d2r8qa_ a.211.1.0 (A:) automated matches {Leishmania major [TaxId: 5664]}
viavtpeereavmsidfggaydftspgfnlfevrekysepmdaaagvvynllwnsglpek
fgcreqtllnfilqcrrryrrvpyhnfyhvvdvcqtlhtylytgkaselltelecyvllv
talvhdldhmgvnnsfylktdsplgilssasgnnsvlevhhcslaieilsdpaadvfegl
sgqdvayayralidcvlatdmakhadalsrftelatsgfekdndthrrlvmetlikagdv
snvtkpfetsrmwamavteefyrqgdmekekgvevlpmfdrsknnelargqigfidfvag
kffrdivgnlfhgmqwcvdtvnsnrakwqeildgr

Timeline for d2r8qa_:

• d2r8qa_ first appeared in SCOPe 2.04
  
• d2r8qa_ appears in SCOPe 2.06
  
• d2r8qa_ appears in the current release, SCOPe 2.08