Lineage for d2r8qa_ (2r8q A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2015250Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2015251Protein automated matches [190983] (9 species)
    not a true protein
  7. 2015435Species Leishmania major [TaxId:5664] [255578] (1 PDB entry)
  8. 2015436Domain d2r8qa_: 2r8q A: [243663]
    automated match to d4i15a_
    complexed with ibm, mg, zn

Details for d2r8qa_

PDB Entry: 2r8q (more details), 1.5 Å

PDB Description: Structure of LmjPDEB1 in complex with IBMX
PDB Compounds: (A:) Class I phosphodiesterase PDEB1

SCOPe Domain Sequences for d2r8qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r8qa_ a.211.1.0 (A:) automated matches {Leishmania major [TaxId: 5664]}
viavtpeereavmsidfggaydftspgfnlfevrekysepmdaaagvvynllwnsglpek
fgcreqtllnfilqcrrryrrvpyhnfyhvvdvcqtlhtylytgkaselltelecyvllv
talvhdldhmgvnnsfylktdsplgilssasgnnsvlevhhcslaieilsdpaadvfegl
sgqdvayayralidcvlatdmakhadalsrftelatsgfekdndthrrlvmetlikagdv
snvtkpfetsrmwamavteefyrqgdmekekgvevlpmfdrsknnelargqigfidfvag
kffrdivgnlfhgmqwcvdtvnsnrakwqeildgr

SCOPe Domain Coordinates for d2r8qa_:

Click to download the PDB-style file with coordinates for d2r8qa_.
(The format of our PDB-style files is described here.)

Timeline for d2r8qa_: