SCOPe 2.06: Domain d2qt6b3: 2qt6 B:300-498

Lineage for d2qt6b3 (2qt6 B:300-498)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (23 species)
   not a true protein

7. Species Lentinus tigrinus [TaxId:5365] [255573] (1 PDB entry)

8. Domain d2qt6b3: 2qt6 B:300-498 [243643]
   automated match to d1a65a3
   complexed with ca, cbs, cl, cu, gol, man, nag, per, tla

Details for d2qt6b3

PDB Entry: 2qt6, 1.5 Å

PDB Description: crystal structure determination of a blue laccase from lentinus tigrinus

PDB Compounds: (B:) laccase

SCOPe Domain Sequences for d2qt6b3:

Sequence; same for both SEQRES and ATOM records:

>d2qt6b3 b.6.1.0 (B:300-498) automated matches {Lentinus tigrinus [TaxId: 5365]}
letdlhpltsmpvpgnptqggadlnlnmafnfdgtnffingesftpptvpvllqiisgan
taqdllpsgsvyslpsnssieitfpattaapgaphpfhlhghvfavvrsagstsynyddp
vwrdvvstgtpqagdnvtirfqtdnpgpwflhchidfhldagfavvmaedipntvnanpv
pqawsnlcptydalepsne

Timeline for d2qt6b3:

• d2qt6b3 first appeared in SCOPe 2.04
  
• d2qt6b3 appears in SCOPe 2.05
  
• d2qt6b3 appears in SCOPe 2.07
  
• d2qt6b3 appears in the current release, SCOPe 2.08