| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
| Protein automated matches [190824] (31 species) not a true protein |
| Species Lentinus tigrinus [TaxId:5365] [255573] (1 PDB entry) |
| Domain d2qt6b3: 2qt6 B:300-498 [243643] automated match to d1a65a3 complexed with ca, cl, cu, gol, man, nag, per, tla |
PDB Entry: 2qt6 (more details), 1.5 Å
SCOPe Domain Sequences for d2qt6b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qt6b3 b.6.1.0 (B:300-498) automated matches {Lentinus tigrinus [TaxId: 5365]}
letdlhpltsmpvpgnptqggadlnlnmafnfdgtnffingesftpptvpvllqiisgan
taqdllpsgsvyslpsnssieitfpattaapgaphpfhlhghvfavvrsagstsynyddp
vwrdvvstgtpqagdnvtirfqtdnpgpwflhchidfhldagfavvmaedipntvnanpv
pqawsnlcptydalepsne
Timeline for d2qt6b3: