Lineage for d2qsgx_ (2qsg X:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736202Fold a.189: XPC-binding domain-like [101237] (1 superfamily)
    4 helices; array
  4. 2736203Superfamily a.189.1: XPC-binding domain [101238] (2 families) (S)
  5. 2736222Family a.189.1.0: automated matches [254270] (1 protein)
    not a true family
  6. 2736223Protein automated matches [254625] (1 species)
    not a true protein
  7. 2736224Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255572] (2 PDB entries)
  8. 2736226Domain d2qsgx_: 2qsg X: [243634]
    automated match to d1x3wb1
    protein/DNA complex

Details for d2qsgx_

PDB Entry: 2qsg (more details), 3.1 Å

PDB Description: Crystal structure of Rad4-Rad23 bound to a UV-damaged DNA
PDB Compounds: (X:) UV excision repair protein RAD23

SCOPe Domain Sequences for d2qsgx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qsgx_ a.189.1.0 (X:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gltvedllslrqvvsgnpealapllenisarypqlrehimanpevfvsmlleav

SCOPe Domain Coordinates for d2qsgx_:

Click to download the PDB-style file with coordinates for d2qsgx_.
(The format of our PDB-style files is described here.)

Timeline for d2qsgx_: