PDB entry 2qsg

View 2qsg on RCSB PDB site
Description: Crystal structure of Rad4-Rad23 bound to a UV-damaged DNA
Class: DNA binding protein/DNA
Keywords: alpha-beta structure, beta hairpin, transglutaminase fold, DNA-damage recognition, DNA repair, DNA binding protein, nucleotide excision repair, xeroderma pigmentosum, DNA binding, protein/DNA complex, cyclobutanepyrimidine cpd dimer, ultraviolet uv damage, mismatch DNA, DNA binding protein/DNA complex
Deposited on 2007-07-31, released 2007-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-20.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.248
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA repair protein RAD4
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: RAD4
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14736 (Start-532)
    • see remark 999 (123)
    • see remark 999 (125)
• Chain 'W':
  Compound: native strand of the CPD-mismatch DNA
  
• Chain 'X':
  Compound: UV excision repair protein RAD23
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: RAD23
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32628
  Domains in SCOPe 2.08: d2qsgx_
• Chain 'Y':
  Compound: damaged strand of the CPD-mismatch DNA
  

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'W':
  No sequence available.
  
  
• Chain 'X':
  Sequence, based on SEQRES records: (download)
  

  >2qsgX (X:)
  gsgnassgalgttggatdaaqggppgsigltvedllslrqvvsgnpealapllenisary
  pqlrehimanpevfvsmlleavgdnmqdvmegaddmvegedievtgeaaaaglgqgegeg
  sfqvdytpeddqaisrlcelgferdlviqvyfacdkneeaaanilfsdhad
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2qsgX (X:)
  gltvedllslrqvvsgnpealapllenisarypqlrehimanpevfvsmlleav
  

  
  
• Chain 'Y':
  No sequence available.