SCOPe 2.07: Domain d2qeqb2: 2qeq B:484-619

Lineage for d2qeqb2 (2qeq B:484-619)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species West nile virus [TaxId:11078] [255565] (1 PDB entry)

8. Domain d2qeqb2: 2qeq B:484-619 [243558]
   Other proteins in same PDB: d2qeqa1, d2qeqb1
   automated match to d2bmfa1

Details for d2qeqb2

PDB Entry: 2qeq, 3.1 Å

PDB Description: Crystal structure of kunjin virus ns3 helicase

PDB Compounds: (B:) Flavivirin protease NS3 catalytic subunit

SCOPe Domain Sequences for d2qeqb2:

Sequence; same for both SEQRES and ATOM records:

>d2qeqb2 c.37.1.0 (B:484-619) automated matches {West nile virus [TaxId: 11078]}
sncahwtearimldninmpngliaqfyqperekvytmdgeyrlrgeerknflellrtadl
pvwlaykvaaagvsyhdrrwcfdgprtntilednnevevitklgerkilrprwidarvys
dhqalksfkdfasgkr

Timeline for d2qeqb2:

• d2qeqb2 first appeared in SCOPe 2.04
  
• d2qeqb2 appears in SCOPe 2.06
  
• d2qeqb2 appears in the current release, SCOPe 2.08