SCOPe 2.07: Domain d2qeqb1: 2qeq B:187-483

Lineage for d2qeqb1 (2qeq B:187-483)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (4 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein automated matches [226986] (8 species)
   not a true protein

7. Species West nile virus [TaxId:11078] [255564] (1 PDB entry)

8. Domain d2qeqb1: 2qeq B:187-483 [243557]
   Other proteins in same PDB: d2qeqa2, d2qeqb2
   automated match to d2bhra2

Details for d2qeqb1

PDB Entry: 2qeq, 3.1 Å

PDB Description: Crystal structure of kunjin virus ns3 helicase

PDB Compounds: (B:) Flavivirin protease NS3 catalytic subunit

SCOPe Domain Sequences for d2qeqb1:

Sequence, based on SEQRES records:

>d2qeqb1 c.37.1.14 (B:187-483) automated matches {West nile virus [TaxId: 11078]}
kqitvldlhpgagktrrilpqiikeainrrlrtavlaptrvvaaemaealrglpiryqts
avarehngneivdvmchatlthrlmsphrvpnynlfvmdeahftdpasiaargyistrve
lgeaaaifmtatppgtsdpfpesnapisdlqteipdrawnsgyewiteyigktvwfvpsv
kmgneialclqragkkviqlnrksyeteypkcknddwdfvvttdisemganfkasrvids
rksvkptiitegegrvilgepsavtaasaaqrrgrtgrnpsqagdeycygghtnedd

Sequence, based on observed residues (ATOM records):

>d2qeqb1 c.37.1.14 (B:187-483) automated matches {West nile virus [TaxId: 11078]}
kqitvldktrrilpqiikeainrrlrtavlaptrvvaaemaealrglpiryqtsgneivd
vmchatlthrlmsphrvpnynlfvmdeahftdpasiaargyistrvelgeaaaifmtatp
pgtsdpfpesnapisdlqteipdrawyewiteyigktvwfvpsvkmgneialclqragkk
viqlnwdfvvttdisfkasrvidsrksvkptiitegegrvilgepsavtaasaaqrrgrt
grdeycygghtnedd

Timeline for d2qeqb1:

• d2qeqb1 first appeared in SCOPe 2.04
  
• d2qeqb1 appears in SCOPe 2.06
  
• d2qeqb1 appears in the current release, SCOPe 2.08