Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.14: RNA helicase [52724] (4 proteins) duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension |
Protein automated matches [226986] (8 species) not a true protein |
Species West nile virus [TaxId:11078] [255564] (1 PDB entry) |
Domain d2qeqb1: 2qeq B:187-483 [243557] Other proteins in same PDB: d2qeqa2, d2qeqb2 automated match to d2bhra2 |
PDB Entry: 2qeq (more details), 3.1 Å
SCOPe Domain Sequences for d2qeqb1:
Sequence, based on SEQRES records: (download)
>d2qeqb1 c.37.1.14 (B:187-483) automated matches {West nile virus [TaxId: 11078]} kqitvldlhpgagktrrilpqiikeainrrlrtavlaptrvvaaemaealrglpiryqts avarehngneivdvmchatlthrlmsphrvpnynlfvmdeahftdpasiaargyistrve lgeaaaifmtatppgtsdpfpesnapisdlqteipdrawnsgyewiteyigktvwfvpsv kmgneialclqragkkviqlnrksyeteypkcknddwdfvvttdisemganfkasrvids rksvkptiitegegrvilgepsavtaasaaqrrgrtgrnpsqagdeycygghtnedd
>d2qeqb1 c.37.1.14 (B:187-483) automated matches {West nile virus [TaxId: 11078]} kqitvldktrrilpqiikeainrrlrtavlaptrvvaaemaealrglpiryqtsgneivd vmchatlthrlmsphrvpnynlfvmdeahftdpasiaargyistrvelgeaaaifmtatp pgtsdpfpesnapisdlqteipdrawyewiteyigktvwfvpsvkmgneialclqragkk viqlnwdfvvttdisfkasrvidsrksvkptiitegegrvilgepsavtaasaaqrrgrt grdeycygghtnedd
Timeline for d2qeqb1: