![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (319 species) not a true protein |
![]() | Species Bordetella bronchiseptica [TaxId:518] [225344] (8 PDB entries) |
![]() | Domain d2q1ub_: 2q1u B: [243518] automated match to d1r6da_ complexed with gol, nad, udp |
PDB Entry: 2q1u (more details), 1.7 Å
SCOPe Domain Sequences for d2q1ub_:
Sequence, based on SEQRES records: (download)
>d2q1ub_ c.2.1.0 (B:) automated matches {Bordetella bronchiseptica [TaxId: 518]} asklantnvmvvggagfvgsnlvkrllelgvnqvhvvdnllsaekinvpdhpavrfsets itddallaslqdeydyvfhlatyhgnqssihdpladhenntlttlklyerlkhfkrlkkv vysaagcsiaektfddakateetdivslhnndspysmskifgefysvyyhkqhqlptvra rfqnvygpgeilgagrwrgtpatvwrnvtptfiykalkgmplplenggvatrdfifvedv angliacaadgtpggvyniasgketsiadlatkineitgnnteldrlpkrpwdnsgkrfg spekarrelgfsadvsiddglrktiewtkanlavieqimrkhdsalaty
>d2q1ub_ c.2.1.0 (B:) automated matches {Bordetella bronchiseptica [TaxId: 518]} asklantnvmvvggagfvgsnlvkrllelgvnqvhvvdnllsaekinvpdhpavrfsets itddallaslqdeydyvfhlatyhgnqssihdpladhenntlttlklyerlkhfkrlkkv vysaageetdivslhnndspysmskifgefysvyyhkqhqlptvrarfqnvygpgeilga grwrgtpatvwrnvtptfiykalkgmplplenggvatrdfifvedvangliacaadgtpg gvyniasgketsiadlatkineitgnnteldrlpkrpwdnsgkrfgspekarrelgfsad vsiddglrktiewtkanlavieqimrkhdsalaty
Timeline for d2q1ub_: