SCOPe 2.07: Domain d2q17e_: 2q17 E:

Lineage for d2q17e_ (2q17 E:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (20 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:100226] [255552] (2 PDB entries)

8. Domain d2q17e_: 2q17 E: [243517]
   automated match to d1y1hx_
   complexed with ca

Details for d2q17e_

PDB Entry: 2q17, 2.1 Å

PDB Description: Formylglycine Generating Enzyme from Streptomyces coelicolor

PDB Compounds: (E:) formylglycine generating enzyme

SCOPe Domain Sequences for d2q17e_:

Sequence; same for both SEQRES and ATOM records:

>d2q17e_ d.169.1.0 (E:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
rprstrgqvrlpggefamgdafgegypadgetpvhtvrlrpfhidetavtnarfaafvka
tghvtdaerfgssavfhlvvaapdadvlgsaagapwwinvrgahwrrpegarsditgrpn
hpvvhvswndatayarwagkrlpteaeweyaargglagrryawgdeltpggrwrcniwqg
rfphvntaedghlstapvksyrpnghglwntagnvwewcsdwfsptyyaesptvdphgpg
tgaarvlrggsylchdsycnryrvaarssntpdsssgnlgfrcandadl

Timeline for d2q17e_:

• d2q17e_ first appeared in SCOPe 2.04
  
• d2q17e_ appears in SCOPe 2.06
  
• d2q17e_ appears in the current release, SCOPe 2.08