Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (20 species) not a true protein |
Species Streptomyces coelicolor [TaxId:100226] [255552] (2 PDB entries) |
Domain d2q17d_: 2q17 D: [243516] automated match to d1y1hx_ complexed with ca |
PDB Entry: 2q17 (more details), 2.1 Å
SCOPe Domain Sequences for d2q17d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q17d_ d.169.1.0 (D:) automated matches {Streptomyces coelicolor [TaxId: 100226]} prstrgqvrlpggefamgdafgegypadgetpvhtvrlrpfhidetavtnarfaafvkat ghvtdaerfgssavfhlvvaapdadvlgsaagapwwinvrgahwrrpegarsditgrpnh pvvhvswndatayarwagkrlpteaeweyaargglagrryawgdeltpggrwrcniwqgr fphvntaedghlstapvksyrpnghglwntagnvwewcsdwfsptyyaesptvdphgpgt gaarvlrggsylchdsycnryrvaarssntpdsssgnlgfrcanda
Timeline for d2q17d_:
View in 3D Domains from other chains: (mouse over for more information) d2q17a_, d2q17b_, d2q17c_, d2q17e_ |