SCOPe 2.08: Domain d1f5ja_: 1f5j A:

Lineage for d1f5ja_ (1f5j A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (21 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Dictyoglomus thermophilum [TaxId:14] [49990] (1 PDB entry)

8. Domain d1f5ja_: 1f5j A: [24342]
   complexed with so4

Details for d1f5ja_

PDB Entry: 1f5j, 1.8 Å

PDB Description: crystal structure of xynb, a highly thermostable beta-1,4-xylanase from dictyoglomus thermophilum rt46b.1, at 1.8 a resolution

PDB Compounds: (A:) beta-1,4-xylanase

SCOPe Domain Sequences for d1f5ja_:

Sequence; same for both SEQRES and ATOM records:

>d1f5ja_ b.29.1.11 (A:) Xylanase II {Dictyoglomus thermophilum [TaxId: 14]}
altsnasgtfdgyyyelwkdtgnttmtvytqgrfscqwsninnalfrtgkkynqnwqslg
tiritysatynpngnsylciygwstnplvefyiveswgnwrppgatslgqvtidggtydi
yrttrvnqpsivgtatfdqywsvrtskrtsgtvtvtdhfrawanrglnlgtidqitlcve
gyqssgsanitqntfsqss

Timeline for d1f5ja_:

• d1f5ja_ first appeared (with stable ids) in SCOP 1.55
  
• d1f5ja_ appears in SCOPe 2.07