SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1f5ja_ (1f5j A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043667Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 protein domains)
  6. 2043712Protein Xylanase II [49979] (19 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2043783Species Dictyoglomus thermophilum [TaxId:14] [49990] (1 PDB entry)
  8. 2043784Domain d1f5ja_: 1f5j A: [24342]
    complexed with so4

Details for d1f5ja_

PDB Entry: 1f5j (more details), 1.8 Å

PDB Description: crystal structure of xynb, a highly thermostable beta-1,4-xylanase from dictyoglomus thermophilum rt46b.1, at 1.8 a resolution
PDB Compounds: (A:) beta-1,4-xylanase

SCOPe Domain Sequences for d1f5ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5ja_ b.29.1.11 (A:) Xylanase II {Dictyoglomus thermophilum [TaxId: 14]}
altsnasgtfdgyyyelwkdtgnttmtvytqgrfscqwsninnalfrtgkkynqnwqslg
tiritysatynpngnsylciygwstnplvefyiveswgnwrppgatslgqvtidggtydi
yrttrvnqpsivgtatfdqywsvrtskrtsgtvtvtdhfrawanrglnlgtidqitlcve
gyqssgsanitqntfsqss

SCOPe Domain Coordinates for d1f5ja_:

Click to download the PDB-style file with coordinates for d1f5ja_.
(The format of our PDB-style files is described here.)

Timeline for d1f5ja_: