Lineage for d1f5ja_ (1f5j A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043667Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 protein domains)
  6. 2043712Protein Xylanase II [49979] (19 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2043783Species Dictyoglomus thermophilum [TaxId:14] [49990] (1 PDB entry)
  8. 2043784Domain d1f5ja_: 1f5j A: [24342]
    complexed with so4

Details for d1f5ja_

PDB Entry: 1f5j (more details), 1.8 Å

PDB Description: crystal structure of xynb, a highly thermostable beta-1,4-xylanase from dictyoglomus thermophilum rt46b.1, at 1.8 a resolution
PDB Compounds: (A:) beta-1,4-xylanase

SCOPe Domain Sequences for d1f5ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5ja_ b.29.1.11 (A:) Xylanase II {Dictyoglomus thermophilum [TaxId: 14]}
altsnasgtfdgyyyelwkdtgnttmtvytqgrfscqwsninnalfrtgkkynqnwqslg
tiritysatynpngnsylciygwstnplvefyiveswgnwrppgatslgqvtidggtydi
yrttrvnqpsivgtatfdqywsvrtskrtsgtvtvtdhfrawanrglnlgtidqitlcve
gyqssgsanitqntfsqss

SCOPe Domain Coordinates for d1f5ja_:

Click to download the PDB-style file with coordinates for d1f5ja_.
(The format of our PDB-style files is described here.)

Timeline for d1f5ja_: