Lineage for d1f5ja_ (1f5j A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.11: Xylanase/endoglucanase 12 [49978] (2 proteins) 
Protein Xylanase II [49979] (11 species) 
Species Dictyoglomus thermophilum [TaxId:14] [49990] (1 PDB entry) 
Domain d1f5ja_: 1f5j A: [24342]
Details for d1f5ja_
PDB Entry: 1f5j (more details), 1.8 Å
PDB Description: crystal structure of xynb, a highly thermostable beta-1,4-xylanase from dictyoglomus thermophilum rt46b.1, at 1.8 a resolution
SCOP Domain Sequences for d1f5ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f5ja_ b.29.1.11 (A:) Xylanase II {Dictyoglomus thermophilum}
altsnasgtfdgyyyelwkdtgnttmtvytqgrfscqwsninnalfrtgkkynqnwqslg
tiritysatynpngnsylciygwstnplvefyiveswgnwrppgatslgqvtidggtydi
yrttrvnqpsivgtatfdqywsvrtskrtsgtvtvtdhfrawanrglnlgtidqitlcve
gyqssgsanitqntfsqss
SCOP Domain Coordinates for d1f5ja_:
Click to download the PDB-style file with coordinates for d1f5ja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f5ja_:
- d1f5ja_ appears in SCOP 1.57
- d1f5ja_ appears in the current release, SCOPe 2.08
View in 3D
