| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.298: RelE-like [143010] (1 superfamily) beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432 |
Superfamily d.298.1: RelE-like [143011] (3 families) ![]() Toxin component of plasmid stabilisation system |
| Family d.298.1.0: automated matches [191658] (1 protein) not a true family |
| Protein automated matches [191236] (5 species) not a true protein |
| Species Helicobacter pylori [TaxId:85962] [255534] (2 PDB entries) |
| Domain d2otra_: 2otr A: [243380] automated match to d4ltta_ |
PDB Entry: 2otr (more details)
SCOPe Domain Sequences for d2otra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otra_ d.298.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
mltietskkfdkdlkilvkngfdlkllykvvgnlateqplapkykdhplkgglkdfrech
lkpdlllvyqikkqentlflvrlgshself
Timeline for d2otra_: