Lineage for d2otra_ (2otr A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010146Fold d.298: RelE-like [143010] (1 superfamily)
    beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432
  4. 3010147Superfamily d.298.1: RelE-like [143011] (3 families) (S)
    Toxin component of plasmid stabilisation system
  5. 3010183Family d.298.1.0: automated matches [191658] (1 protein)
    not a true family
  6. 3010184Protein automated matches [191236] (7 species)
    not a true protein
  7. 3010208Species Helicobacter pylori [TaxId:85962] [255534] (2 PDB entries)
  8. 3010211Domain d2otra_: 2otr A: [243380]
    automated match to d4ltta_

Details for d2otra_

PDB Entry: 2otr (more details)

PDB Description: Solution Structure of Conserved Hypothetical Protein HP0892 from Helicobacter pylori
PDB Compounds: (A:) Hypothetical protein HP0892

SCOPe Domain Sequences for d2otra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otra_ d.298.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
mltietskkfdkdlkilvkngfdlkllykvvgnlateqplapkykdhplkgglkdfrech
lkpdlllvyqikkqentlflvrlgshself

SCOPe Domain Coordinates for d2otra_:

Click to download the PDB-style file with coordinates for d2otra_.
(The format of our PDB-style files is described here.)

Timeline for d2otra_: