Lineage for d2mcna_ (2mcn A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536113Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1536554Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1536555Protein automated matches [190457] (8 species)
    not a true protein
  7. 1536716Species Mouse (Mus musculus) [TaxId:10090] [189303] (21 PDB entries)
  8. 1536727Domain d2mcna_: 2mcn A: [243169]
    Other proteins in same PDB: d2mcnb_
    automated match to d2j6ka_

Details for d2mcna_

PDB Entry: 2mcn (more details)

PDB Description: distinct ubiquitin binding modes exhibited by sh3 domains: molecular determinants and functional implications
PDB Compounds: (A:) CD2-associated protein

SCOPe Domain Sequences for d2mcna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mcna_ b.34.2.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeik

SCOPe Domain Coordinates for d2mcna_:

Click to download the PDB-style file with coordinates for d2mcna_.
(The format of our PDB-style files is described here.)

Timeline for d2mcna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2mcnb_