SCOPe 2.08: Domain d2m9wa1: 2m9w A:4-63

Lineage for d2m9wa1 (2m9w A:4-63)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (2 proteins)
   single zinc-binding motif

6. Protein automated matches [190940] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255495] (3 PDB entries)

8. Domain d2m9wa1: 2m9w A:4-63 [243152]
   Other proteins in same PDB: d2m9wa2
   automated match to d3dfxa_
   complexed with zn

Details for d2m9wa1

PDB Entry: 2m9w

PDB Description: Solution NMR Structure of Transcription Factor GATA-4 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR4783B

PDB Compounds: (A:) Transcription factor GATA-4

SCOPe Domain Sequences for d2m9wa1:

Sequence; same for both SEQRES and ATOM records:

>d2m9wa1 g.39.1.1 (A:4-63) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sasrrvglscancqtttttlwrrnaegepvcnacglymklhgvprplamrkegiqtrkrk

Timeline for d2m9wa1:

• d2m9wa1 first appeared in SCOPe 2.04, called d2m9wa_
  
• d2m9wa1 appears in SCOPe 2.07