PDB entry 2m9w

View 2m9w on RCSB PDB site
Description: Solution NMR Structure of Transcription Factor GATA-4 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR4783B
Class: transcription
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-Biology, Protein Structure Initiative, TRANSCRIPTION
Deposited on 2013-06-20, released 2013-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription factor GATA-4
    Species: Homo sapiens [TaxId:9606]
    Gene: GATA4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43694 (3-62)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d2m9wa1, d2m9wa2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2m9wA (A:)
shmsasrrvglscancqtttttlwrrnaegepvcnacglymklhgvprplamrkegiqtr
krk