SCOP 1.59: Domain d1bcx__: 1bcx -

Lineage for d1bcx__ (1bcx -)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (12 families)

5. Family b.29.1.11: Xylanase/endoglucanase 12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (12 species)

7. Species Bacillus circulans [TaxId:1397] [49980] (9 PDB entries)

8. Domain d1bcx__: 1bcx - [24312]

Details for d1bcx__

PDB Entry: 1bcx, 1.8 Å

PDB Description: mutational and crystallographic analyses of the active site residues of the bacillus circulans xylanase

SCOP Domain Sequences for d1bcx__:

Sequence; same for both SEQRES and ATOM records:

>d1bcx__ b.29.1.11 (-) Xylanase II {Bacillus circulans}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmatcgyqssgss
nvtvw

Timeline for d1bcx__:

• d1bcx__ first appeared (with stable ids) in SCOP 1.55
  
• d1bcx__ appears in SCOP 1.57
  
• d1bcx__ appears in SCOP 1.61
  
• d1bcx__ appears in the current release, SCOPe 2.08, called d1bcxa_