Lineage for d1bcx__ (1bcx -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.11: Xylanase/endoglucanase 12 [49978] (2 proteins) 
Protein Xylanase II [49979] (11 species) Species Bacillus circulans [TaxId:1397] [49980] (7 PDB entries) 
Domain d1bcx__: 1bcx - [24312]
Details for d1bcx__
PDB Entry: 1bcx (more details), 1.8 Å
PDB Description: mutational and crystallographic analyses of the active site residues of the bacillus circulans xylanase
SCOP Domain Sequences for d1bcx__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bcx__ b.29.1.11 (-) Xylanase II {Bacillus circulans}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmatcgyqssgss
nvtvw
SCOP Domain Coordinates for d1bcx__:
Click to download the PDB-style file with coordinates for d1bcx__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bcx__:
- d1bcx__ appears in SCOP 1.57
- d1bcx__ appears in the current release, SCOPe 2.08, called d1bcxa_
View in 3D