Lineage for d2bvva_ (2bvv A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943754Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 943755Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 944939Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 944984Protein Xylanase II [49979] (17 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 945007Species Bacillus circulans [TaxId:1397] [49980] (11 PDB entries)
  8. 945009Domain d2bvva_: 2bvv A: [24309]

Details for d2bvva_

PDB Entry: 2bvv (more details), 1.5 Å

PDB Description: sugar ring distortion in the glycosyl-enzyme intermediate of a family g/11 xylanase.
PDB Compounds: (A:) protein (endo-1,4-beta-xylanase)

SCOPe Domain Sequences for d2bvva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvva_ b.29.1.11 (A:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlfgwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

SCOPe Domain Coordinates for d2bvva_:

Click to download the PDB-style file with coordinates for d2bvva_.
(The format of our PDB-style files is described here.)

Timeline for d2bvva_: