SCOP 1.65: Domain d1xnb__: 1xnb -

Lineage for d1xnb__ (1xnb -)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (15 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus circulans [TaxId:1397] [49980] (9 PDB entries)

8. Domain d1xnb__: 1xnb - [24308]
   complexed with so4

Details for d1xnb__

PDB Entry: 1xnb, 1.49 Å

PDB Description: high-resolution structures of xylanases from b. circulans and t. harzianum identify a new folding pattern and implications for the atomic basis of the catalysis

SCOP Domain Sequences for d1xnb__:

Sequence; same for both SEQRES and ATOM records:

>d1xnb__ b.29.1.11 (-) Xylanase II {Bacillus circulans}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

Timeline for d1xnb__:

• d1xnb__ first appeared (with stable ids) in SCOP 1.55
  
• d1xnb__ appears in SCOP 1.63
  
• d1xnb__ appears in SCOP 1.67
  
• d1xnb__ appears in the current release, SCOPe 2.08, called d1xnba_