PDB entry 1xnb

View 1xnb on RCSB PDB site
Description: high-resolution structures of xylanases from b. circulans and t. harzianum identify a new folding pattern and implications for the atomic basis of the catalysis
Deposited on 1994-06-01, released 1994-12-20
The last revision prior to the SCOP 1.65 freeze date was dated 1994-12-20, with a file datestamp of 1995-01-05.
Experiment type: -
Resolution: 1.49 Å
R-factor: 0.165
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1xnb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xnb_ (-)
    astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
    ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
    drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
    nvtvw