Lineage for d1xnb__ (1xnb -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12850Family b.29.1.11: Xylanase/endoglucanase 12 [49978] (2 protein domains)
  6. 12855Protein Xylanase II [49979] (11 species)
  7. 12868Species Bacillus circulans [TaxId:1397] [49980] (7 PDB entries)
  8. 12869Domain d1xnb__: 1xnb - [24308]

Details for d1xnb__

PDB Entry: 1xnb (more details), 1.49 Å

PDB Description: high-resolution structures of xylanases from b. circulans and t. harzianum identify a new folding pattern and implications for the atomic basis of the catalysis

SCOP Domain Sequences for d1xnb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnb__ b.29.1.11 (-) Xylanase II {Bacillus circulans}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

SCOP Domain Coordinates for d1xnb__:

Click to download the PDB-style file with coordinates for d1xnb__.
(The format of our PDB-style files is described here.)

Timeline for d1xnb__: