Lineage for d2lrkc_ (2lrk C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724371Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1724417Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families) (S)
  5. 1724427Family a.7.2.0: automated matches [191602] (1 protein)
    not a true family
  6. 1724428Protein automated matches [191097] (4 species)
    not a true protein
  7. 1724439Species Escherichia coli K-12 [TaxId:83333] [255453] (2 PDB entries)
  8. 1724445Domain d2lrkc_: 2lrk C: [242973]
    Other proteins in same PDB: d2lrkd_
    automated match to d3l8ra_

Details for d2lrkc_

PDB Entry: 2lrk (more details)

PDB Description: Solution Structures of the IIA(Chitobiose)-HPr complex of the N,N'-Diacetylchitobiose
PDB Compounds: (C:) n,n'-diacetylchitobiose-specific phosphotransferase enzyme iia component

SCOPe Domain Sequences for d2lrkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lrkc_ a.7.2.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
aeeleevvmgliinsgqarslayaalkqakqgdfaaakammdqsrmalneahlvqtklie
gdagegkmkvslvlveaqlhlmtsmlarelitelielheklka

SCOPe Domain Coordinates for d2lrkc_:

Click to download the PDB-style file with coordinates for d2lrkc_.
(The format of our PDB-style files is described here.)

Timeline for d2lrkc_: