Lineage for d3l8ra_ (3l8r A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724371Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1724417Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families) (S)
  5. 1724427Family a.7.2.0: automated matches [191602] (1 protein)
    not a true family
  6. 1724428Protein automated matches [191097] (4 species)
    not a true protein
  7. 1724450Species Streptococcus mutans [TaxId:1309] [189195] (1 PDB entry)
  8. 1724451Domain d3l8ra_: 3l8r A: [180084]
    automated match to d1e2aa_

Details for d3l8ra_

PDB Entry: 3l8r (more details), 2.5 Å

PDB Description: The crystal structure of PtcA from S. mutans
PDB Compounds: (A:) Putative PTS system, cellobiose-specific IIA component

SCOPe Domain Sequences for d3l8ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l8ra_ a.7.2.0 (A:) automated matches {Streptococcus mutans [TaxId: 1309]}
mnteelqvaafeiilnsgnarsivheafdamreknyilaeqklqeandellkahqaqtdl
lqeyasgteikieiimvhaqdhlmttmtlrevaiemlelykk

SCOPe Domain Coordinates for d3l8ra_:

Click to download the PDB-style file with coordinates for d3l8ra_.
(The format of our PDB-style files is described here.)

Timeline for d3l8ra_: