SCOPe 2.08: Domain d2l85a1: 2l85 A:1081-1197

Lineage for d2l85a1 (2l85 A:1081-1197)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (6 proteins)

6. Protein CREB-binding protein, CBP [74712] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74713] (59 PDB entries)

8. Domain d2l85a1: 2l85 A:1081-1197 [242804]
   Other proteins in same PDB: d2l85a2
   automated match to d2rnya1
   complexed with l85

Details for d2l85a1

PDB Entry: 2l85

PDB Description: Solution NMR structures of CBP bromodomain with small molecule of HBS

PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d2l85a1:

Sequence; same for both SEQRES and ATOM records:

>d2l85a1 a.29.2.1 (A:1081-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
rkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikr
kldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

Timeline for d2l85a1:

• d2l85a1 first appeared in SCOPe 2.04, called d2l85a_
  
• d2l85a1 appears in SCOPe 2.07