PDB entry 2l85

View 2l85 on RCSB PDB site
Description: Solution NMR structures of CBP bromodomain with small molecule of HBS
Class: transferase
Keywords: p53, transferase
Deposited on 2011-01-04, released 2011-01-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92793 (4-120)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d2l85a1, d2l85a2
  • Heterogens: L85

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l85A (A:)
    gshmrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdls
    tikrkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl
    g