SCOPe 2.05: Domain d2l7ib_: 2l7i B:

Lineage for d2l7ib_ (2l7i B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.274: HAMP domain-like [158471] (1 superfamily)
   dimer of helix-loop-helix segments; distict from the HLH-like fold; parallel four-helical bundle with two overside connections

4. Superfamily a.274.1: HAMP domain-like [158472] (1 family)
   automatically mapped to Pfam PF00672

5. Family a.274.1.1: HAMP domain [158473] (2 proteins)
   Pfam PF00672

6. Protein Hypothetical protein AF1503 [158474] (1 species)
   C-terminal domain

7. Species Archaeoglobus fulgidus [TaxId:2234] [158475] (2 PDB entries)
   Uniprot O28769 278-331

8. Domain d2l7ib_: 2l7i B: [242797]
   automated match to d2l7ha_

Details for d2l7ib_

PDB Entry: 2l7i

PDB Description: The solution structure of the HAMP domain of the hypothetical transmembrane receptor Af1503 (A291F variant)

PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d2l7ib_:

Sequence; same for both SEQRES and ATOM records:

>d2l7ib_ a.274.1.1 (B:) Hypothetical protein AF1503 {Archaeoglobus fulgidus [TaxId: 2234]}
gshmstitrpiielsntfdkiaegnleaevphqnradeigilaksierlrrslkvame

Timeline for d2l7ib_:

• d2l7ib_ first appeared in SCOPe 2.04
  
• d2l7ib_ is called d2l7ib1 in SCOPe 2.06
  
• d2l7ib_ appears in the current release, SCOPe 2.08, called d2l7ib1