| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.274: HAMP domain-like [158471] (1 superfamily) dimer of helix-loop-helix segments; distict from the HLH-like fold; parallel four-helical bundle with two overside connections |
Superfamily a.274.1: HAMP domain-like [158472] (1 family) ![]() automatically mapped to Pfam PF00672 |
| Family a.274.1.1: HAMP domain [158473] (2 proteins) Pfam PF00672 |
| Protein Hypothetical protein AF1503 [158474] (1 species) C-terminal domain |
| Species Archaeoglobus fulgidus [TaxId:2234] [158475] (2 PDB entries) Uniprot O28769 278-331 |
| Domain d2l7ib1: 2l7i B:278-331 [242797] Other proteins in same PDB: d2l7ia2, d2l7ib2 automated match to d2l7ha_ |
PDB Entry: 2l7i (more details)
SCOPe Domain Sequences for d2l7ib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l7ib1 a.274.1.1 (B:278-331) Hypothetical protein AF1503 {Archaeoglobus fulgidus [TaxId: 2234]}
stitrpiielsntfdkiaegnleaevphqnradeigilaksierlrrslkvame
Timeline for d2l7ib1: