SCOPe 2.07: Domain d2l4xa_: 2l4x A:

Lineage for d2l4xa_ (2l4x A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.224: SufE/NifU [82648] (1 superfamily)
   alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123

4. Superfamily d.224.1: SufE/NifU [82649] (4 families)
   iron-sulfur cluster assembly proteins

5. Family d.224.1.2: NifU/IscU domain [102928] (5 proteins)

6. Protein automated matches [254586] (5 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [255406] (1 PDB entry)

8. Domain d2l4xa_: 2l4x A: [242768]
   automated match to d1r9pa_

Details for d2l4xa_

PDB Entry: 2l4x

PDB Description: Solution Structure of apo-IscU(WT)

PDB Compounds: (A:) Iron-sulfur cluster assembly scaffold protein

SCOPe Domain Sequences for d2l4xa_:

Sequence; same for both SEQRES and ATOM records:

>d2l4xa_ d.224.1.2 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
maysekvidhyenprnvgsfdnndenvgsgmvgapacgdvmklqikvndegiiedarfkt
ygcgsaiassslvtewvkgksldeaqaikntdiaeelelppvkihcsilaedaikaaiad
ykskreak

Timeline for d2l4xa_:

• d2l4xa_ first appeared in SCOPe 2.04
  
• d2l4xa_ appears in SCOPe 2.06
  
• d2l4xa_ appears in the current release, SCOPe 2.08