Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) iron-sulfur cluster assembly proteins |
Family d.224.1.2: NifU/IscU domain [102928] (5 proteins) |
Protein automated matches [254586] (5 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255406] (1 PDB entry) |
Domain d2l4xa_: 2l4x A: [242768] automated match to d1r9pa_ |
PDB Entry: 2l4x (more details)
SCOPe Domain Sequences for d2l4xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l4xa_ d.224.1.2 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} maysekvidhyenprnvgsfdnndenvgsgmvgapacgdvmklqikvndegiiedarfkt ygcgsaiassslvtewvkgksldeaqaikntdiaeelelppvkihcsilaedaikaaiad ykskreak
Timeline for d2l4xa_: