SCOPe 2.08: Domain d2ku1a1: 2ku1 A:1-233

Lineage for d2ku1a1 (2ku1 A:1-233)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Thermoplasma acidophilum [TaxId:2303] [56256] (8 PDB entries)

8. Domain d2ku1a1: 2ku1 A:1-233 [242650]
   Other proteins in same PDB: d2ku1a2, d2ku1b2, d2ku1c2, d2ku1d2, d2ku1e2, d2ku1f2, d2ku1g2
   automated match to d1ya7a_

Details for d2ku1a1

PDB Entry: 2ku1

PDB Description: dynamic regulation of archaeal proteasome gate opening as studied by trosy-nmr

PDB Compounds: (A:) Proteasome subunit alpha

SCOPe Domain Sequences for d2ku1a1:

Sequence; same for both SEQRES and ATOM records:

>d2ku1a1 d.153.1.4 (A:1-233) Proteasome alpha subunit (non-catalytic) {Thermoplasma acidophilum [TaxId: 2303]}
mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl

Timeline for d2ku1a1:

• d2ku1a1 first appeared in SCOPe 2.04, called d2ku1a_
  
• d2ku1a1 appears in SCOPe 2.07