![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins) automatically mapped to Pfam PF00354 |
![]() | Protein C-reactive protein (CRP) [49954] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49955] (6 PDB entries) |
![]() | Domain d1b09e_: 1b09 E: [24251] complexed with phosphocholine complexed with ca, pc |
PDB Entry: 1b09 (more details), 2.5 Å
SCOPe Domain Sequences for d1b09e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b09e_ b.29.1.5 (E:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]} qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf spnvlnwralkyevqgevftkpqlwp
Timeline for d1b09e_:
![]() Domains from other chains: (mouse over for more information) d1b09a_, d1b09b_, d1b09c_, d1b09d_ |