Lineage for d1b09e_ (1b09 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779650Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
    automatically mapped to Pfam PF00354
  6. 2779651Protein C-reactive protein (CRP) [49954] (1 species)
  7. 2779652Species Human (Homo sapiens) [TaxId:9606] [49955] (6 PDB entries)
  8. 2779677Domain d1b09e_: 1b09 E: [24251]
    complexed with phosphocholine
    complexed with ca, pc

Details for d1b09e_

PDB Entry: 1b09 (more details), 2.5 Å

PDB Description: human c-reactive protein complexed with phosphocholine
PDB Compounds: (E:) protein (c-reactive protein)

SCOPe Domain Sequences for d1b09e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b09e_ b.29.1.5 (E:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]}
qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
spnvlnwralkyevqgevftkpqlwp

SCOPe Domain Coordinates for d1b09e_:

Click to download the PDB-style file with coordinates for d1b09e_.
(The format of our PDB-style files is described here.)

Timeline for d1b09e_: