PDB entry 1b09

View 1b09 on RCSB PDB site
Description: human c-reactive protein complexed with phosphocholine
Class: immune system
Keywords: pentraxin, acute-phase reactant, phosphocholine, immune system
Deposited on 1998-11-18, released 1999-11-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.196
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (c-reactive protein)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b09a_
  • Chain 'B':
    Compound: protein (c-reactive protein)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b09b_
  • Chain 'C':
    Compound: protein (c-reactive protein)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b09c_
  • Chain 'D':
    Compound: protein (c-reactive protein)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b09d_
  • Chain 'E':
    Compound: protein (c-reactive protein)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b09e_
  • Heterogens: CA, PC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b09A (A:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b09B (B:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b09C (C:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b09D (D:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b09E (E:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp