SCOPe 2.05: Domain d2kf2a_: 2kf2 A:

Lineage for d2kf2a_ (2kf2 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (20 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:100226] [255342] (1 PDB entry)

8. Domain d2kf2a_: 2kf2 A: [242491]
   automated match to d3tl1a_

Details for d2kf2a_

PDB Entry: 2kf2

PDB Description: solution nmr structure of of streptomyces coelicolor polyketide cyclase sco5315. northeast structural genomics consortium target rr365

PDB Compounds: (A:) Putative polyketide cyclase

SCOPe Domain Sequences for d2kf2a_:

Sequence; same for both SEQRES and ATOM records:

>d2kf2a_ d.129.3.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
maghtdneitiaapmelvwtmtndiekwpglfseyasvevlgrdddkvtfrltmhpdadg
kvwswvservadpvtrtvraqrvetgpfqymnivweyaetaegtvmrwtqdfamkpdapv
ddawmtdninrnsrtqmalirdrieqaagerrtasvladlehhhhhh

Timeline for d2kf2a_:

• d2kf2a_ first appeared in SCOPe 2.04
  
• d2kf2a_ is called d2kf2a1 in SCOPe 2.06
  
• d2kf2a_ appears in the current release, SCOPe 2.08, called d2kf2a1