Lineage for d2kf2a_ (2kf2 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926121Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1926373Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1926677Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 1926678Protein automated matches [190218] (20 species)
    not a true protein
  7. 1926831Species Streptomyces coelicolor [TaxId:100226] [255342] (1 PDB entry)
  8. 1926832Domain d2kf2a_: 2kf2 A: [242491]
    automated match to d3tl1a_

Details for d2kf2a_

PDB Entry: 2kf2 (more details)

PDB Description: Solution NMR structure of of Streptomyces coelicolor polyketide cyclase SCO5315. Northeast Structural Genomics Consortium target RR365
PDB Compounds: (A:) Putative polyketide cyclase

SCOPe Domain Sequences for d2kf2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kf2a_ d.129.3.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
maghtdneitiaapmelvwtmtndiekwpglfseyasvevlgrdddkvtfrltmhpdadg
kvwswvservadpvtrtvraqrvetgpfqymnivweyaetaegtvmrwtqdfamkpdapv
ddawmtdninrnsrtqmalirdrieqaagerrtasvladlehhhhhh

SCOPe Domain Coordinates for d2kf2a_:

Click to download the PDB-style file with coordinates for d2kf2a_.
(The format of our PDB-style files is described here.)

Timeline for d2kf2a_: