![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
![]() | Protein automated matches [190218] (22 species) not a true protein |
![]() | Species Streptomyces coelicolor [TaxId:100226] [255342] (1 PDB entry) |
![]() | Domain d2kf2a1: 2kf2 A:1-159 [242491] Other proteins in same PDB: d2kf2a2 automated match to d3tl1a_ |
PDB Entry: 2kf2 (more details)
SCOPe Domain Sequences for d2kf2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kf2a1 d.129.3.0 (A:1-159) automated matches {Streptomyces coelicolor [TaxId: 100226]} maghtdneitiaapmelvwtmtndiekwpglfseyasvevlgrdddkvtfrltmhpdadg kvwswvservadpvtrtvraqrvetgpfqymnivweyaetaegtvmrwtqdfamkpdapv ddawmtdninrnsrtqmalirdrieqaagerrtasvlad
Timeline for d2kf2a1: