SCOPe 2.06: Domain d2kf2a1: 2kf2 A:1-159

Lineage for d2kf2a1 (2kf2 A:1-159)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (22 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:100226] [255342] (1 PDB entry)

8. Domain d2kf2a1: 2kf2 A:1-159 [242491]
   Other proteins in same PDB: d2kf2a2
   automated match to d3tl1a_

Details for d2kf2a1

PDB Entry: 2kf2

PDB Description: solution nmr structure of of streptomyces coelicolor polyketide cyclase sco5315. northeast structural genomics consortium target rr365

PDB Compounds: (A:) Putative polyketide cyclase

SCOPe Domain Sequences for d2kf2a1:

Sequence; same for both SEQRES and ATOM records:

>d2kf2a1 d.129.3.0 (A:1-159) automated matches {Streptomyces coelicolor [TaxId: 100226]}
maghtdneitiaapmelvwtmtndiekwpglfseyasvevlgrdddkvtfrltmhpdadg
kvwswvservadpvtrtvraqrvetgpfqymnivweyaetaegtvmrwtqdfamkpdapv
ddawmtdninrnsrtqmalirdrieqaagerrtasvlad

Timeline for d2kf2a1:

• d2kf2a1 first appeared in SCOPe 2.04, called d2kf2a_
  
• d2kf2a1 was called d2kf2a_ in SCOPe 2.05
  
• d2kf2a1 appears in SCOPe 2.07
  
• d2kf2a1 appears in the current release, SCOPe 2.08